PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6DS_C4D93239C.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family SBP
Protein Properties Length: 275aa    MW: 30092.9 Da    PI: 9.0709
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6DS_C4D93239C.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.45.6e-40885178
                           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                    SBP  1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78
                           +CqvegC ++l +akeyhr+h+vCe+h+k p v+v+g+e+rfCqqCsrfh+lsefD++krsCrrrL++hn+rrrk+q+
  Traes_6DS_C4D93239C.1  8 RCQVEGCGVELRDAKEYHRKHRVCEAHTKFPRVVVAGQERRFCQQCSRFHALSEFDQKKRSCRRRLSDHNARRRKPQP 85
                           6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.0E-33470IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.975683IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.54E-39788IPR004333Transcription factor, SBP-box
PfamPF031105.1E-31982IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
GGGGGGVRCQ VEGCGVELRD AKEYHRKHRV CEAHTKFPRV VVAGQERRFC QQCSRFHALS  60
EFDQKKRSCR RRLSDHNARR RKPQPDAFSF APARLPSSLM FDDRRQISFV WNKDPSHARP  120
FPCSPWDSPS DFKLPQVKEI REVSINGQVH FDKSHLPNAV PALSHDIAEL LPMKGPDASV  180
TASKLGGAPD LQHALSLLSA SSCGLPDPVQ QASCLVQFTG ASQNSRGPSP HGGSPPSASC  240
AEGQPMVPSP QFVRFTMDGA SSGYESTFFG VNRMN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-27382484squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16481KKRSCRRRLSDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3616100.0AK361610.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1144O20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570368.11e-159PREDICTED: squamosa promoter-binding-like protein 4
SwissprotQ653Z55e-92SPL11_ORYSJ; Squamosa promoter-binding-like protein 11
TrEMBLW5H4P90.0W5H4P9_WHEAT; Uncharacterized protein
STRINGMLOC_62426.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62712952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.31e-37squamosa promoter binding protein-like 2
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]